PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.15G129200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family WOX
Protein Properties Length: 302aa    MW: 34638.2 Da    PI: 8.47
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.15G129200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.81.4e-2158117357
                          --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
             Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                          +R+++t+eql +Lee++++ +r+p+ae+++++A++l    +++ ++V++WFqN++a+e++
  Manes.15G129200.1.p  58 SRWSPTPEQLLALEEMYRRgTRTPKAEQIQQIAAHLrrfgKIEGKNVFYWFQNHKARERQ 117
                          7*****************99**************************************97 PP

2Wus_type_Homeobox112.22.7e-3657119365
    Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                          ++RW+PtpeQ+  Lee+y++G+rtP++e+iq+i+a+L+++Gkie+kNVfyWFQN+kaRerqk+
  Manes.15G129200.1.p  57 SSRWSPTPEQLLALEEMYRRGTRTPKAEQIQQIAAHLRRFGKIEGKNVFYWFQNHKARERQKR 119
                          79***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.28953118IPR001356Homeobox domain
SMARTSM003893.8E-655122IPR001356Homeobox domain
SuperFamilySSF466897.27E-1358122IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.2E-958117IPR009057Homeodomain-like
PfamPF000463.0E-1958117IPR001356Homeobox domain
CDDcd000862.80E-559119No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MAAKKNELNM NDSVYIAESS SLSYIYMMCM HEGSENNAWD QNRRELIMNE QQLMGMSSRW  60
SPTPEQLLAL EEMYRRGTRT PKAEQIQQIA AHLRRFGKIE GKNVFYWFQN HKARERQKRR  120
RAVEASRKVL RHDITGSLDM KESVELQKKT LVPPSSCSEN LEGPVSILTA GTTESTTPHG  180
CLQIEKRESN QRKSCSLEKK TKWLAVDPCP SYPIHLINNM TTRSSTFLNS QRQSSWFKSN  240
RRTENDENKI GEVETLDLFP LCSEDCSGVN DSKNDTEVAI TAINTKLMSP NQYFEFLPLK  300
N*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002526032.11e-100PREDICTED: WUSCHEL-related homeobox 1
TrEMBLB9SJ631e-100B9SJ63_RICCO; Protein WUSCHEL, putative
STRINGPOPTR_0010s12150.18e-67(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF28923471
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18010.19e-36WUSCHEL related homeobox 1